Lineage for d5sxhb1 (5sxh B:191-378)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2525970Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2526027Protein automated matches [310855] (2 species)
    not a true protein
  7. 2526028Species Human (Homo sapiens) [TaxId:9606] [311219] (22 PDB entries)
  8. 2526038Domain d5sxhb1: 5sxh B:191-378 [347483]
    Other proteins in same PDB: d5sxha2, d5sxhb2
    automated match to d5cqda_
    complexed with edo, zn

Details for d5sxhb1

PDB Entry: 5sxh (more details), 1.78 Å

PDB Description: crystal structure of the cancer genomic dna mutator apobec3b
PDB Compounds: (B:) DNA dC->dU-editing enzyme APOBEC-3B

SCOPe Domain Sequences for d5sxhb1:

Sequence, based on SEQRES records: (download)

>d5sxhb1 c.97.1.6 (B:191-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ylmdpdtftsnfnndplvlrrrqtylcyeverldngtsvkmdqhmgflcnesgrhaelrf
ldlvpslqldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrikaariydydpl
ykealqmlrdagaqvsimtydefeycwdtfvyrqgcpfqpwdgleehsqalsgrlrailq

Sequence, based on observed residues (ATOM records): (download)

>d5sxhb1 c.97.1.6 (B:191-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ylmdpdtftsnfnndplvlrrrqtylcyeverldqhmgflcnesgrhaelrfldlvpslq
ldpaqiyrvtwfiswspcfswgcagevraflqenthvrlrikaariydydplykealqml
rdagaqvsimtydefeycwdtfvyrqgcpfqpwdgleehsqalsgrlrailq

SCOPe Domain Coordinates for d5sxhb1:

Click to download the PDB-style file with coordinates for d5sxhb1.
(The format of our PDB-style files is described here.)

Timeline for d5sxhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5sxhb2