SCOPe 2.07: Domain d1tiaa_: 1tia A:

Lineage for d1tiaa_ (1tia A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)

6. Protein Triacylglycerol lipase [53559] (7 species)

7. Species Penicillium camembertii [TaxId:5075] [53562] (1 PDB entry)

8. Domain d1tiaa_: 1tia A: [34737]
   CA-atoms only

Details for d1tiaa_

PDB Entry: 1tia, 2.1 Å

PDB Description: an unusual buried polar cluster in a family of fungal lipases

PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1tiaa_:

Sequence; same for both SEQRES and ATOM records:

>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]}
dvstseldqfefwvqyaaasyyeadytaqvgdklscskgncpeveatgatvsydfsdsti
tdtagyiavdhtnsavvlafrgsysvrnwvadatfvhtnpglcdgclaelgfwsswklvr
ddiikelkevvaqnpnyelvvvghslgaavatlaatdlrgkgypsaklyayasprvgnaa
lakyitaqgnnfrfthtndpvpklpllsmgyvhvspeywitspnnatvstsdikvidgdv
sfdgntgtglplltdfeahiwyfvqvdagkg

Timeline for d1tiaa_:

• d1tiaa_ first appeared (with stable ids) in SCOP 1.55, called d1tia__
  
• d1tiaa_ appears in SCOPe 2.06
  
• d1tiaa_ appears in the current release, SCOPe 2.08