SCOPe 2.07: Domain d5ol4a_: 5ol4 A:

Lineage for d5ol4a_ (5ol4 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein automated matches [279671] (2 species)
   not a true protein

7. Species Sporosarcina pasteurii [TaxId:1474] [279673] (11 PDB entries)

8. Domain d5ol4a_: 5ol4 A: [347266]
   Other proteins in same PDB: d5ol4b_
   automated match to d5g4ha_
   complexed with 9xn, edo, ni, so4

Details for d5ol4a_

PDB Entry: 5ol4, 1.28 Å

PDB Description: 1.28 a resolution of sporosarcina pasteurii urease inhibited in the presence of nbpt

PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d5ol4a_:

Sequence; same for both SEQRES and ATOM records:

>d5ol4a_ d.8.1.1 (A:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

Timeline for d5ol4a_:

• d5ol4a_ is new in SCOPe 2.07-stable
  
• d5ol4a_ appears in the current release, SCOPe 2.08