SCOPe 2.08: Domain d5o3gb_: 5o3g B:

Lineage for d5o3gb_ (5o3g B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5o3gb_: 5o3g B: [347161]
   automated match to d4qeua_
   complexed with 9j8; mutant

Details for d5o3gb_

PDB Entry: 5o3g, 1.85 Å

PDB Description: human brd2(bd2) mutant in complex with al-am1

PDB Compounds: (B:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d5o3gb_:

Sequence; same for both SEQRES and ATOM records:

>d5o3gb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lseqlkhcngilkellskkhaayawpfykpvdasalgvhdyhdiikhpmdlstvkrkmen
rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp

Timeline for d5o3gb_:

• d5o3gb_ first appeared in SCOPe 2.07