Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.13: Thioesterases [53542] (4 proteins) |
Protein Palmitoyl protein thioesterase 1 [53545] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [53546] (3 PDB entries) |
Domain d1exwa_: 1exw A: [34715] complexed with hds, nag |
PDB Entry: 1exw (more details), 2.4 Å
SCOPe Domain Sequences for d1exwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exwa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} dppaplplviwhgmgdsccnplsmgaikkmvekkipgihvlsleigktlredvensffln vnsqvttvcqilakdpklqqgynamgfsqggqflravaqrcpsppmvnlisvggqhqgvf glprcpgesshicdfirktlnagaynkaiqerlvqaeywhdpirediyrnhsifladinq ergvnesykknlmalkkfvmvkflndtivdpvdsewfgfyrsgqaketiplqestlytqd rlglkamdkagqlvflalegdhlqlseewfyahiipfle
Timeline for d1exwa_: