Lineage for d1exwa_ (1exw A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2475385Family c.69.1.13: Thioesterases [53542] (4 protein domains)
  6. 2475390Protein Palmitoyl protein thioesterase 1 [53545] (1 species)
  7. 2475391Species Cow (Bos taurus) [TaxId:9913] [53546] (3 PDB entries)
  8. 2475393Domain d1exwa_: 1exw A: [34715]
    complexed with hds, nag

Details for d1exwa_

PDB Entry: 1exw (more details), 2.4 Å

PDB Description: crystal structure of palmitoyl protein thioesterase 1 complexed with hexadecylsulfonyl fluoride
PDB Compounds: (A:) palmitoyl protein thioesterase 1

SCOPe Domain Sequences for d1exwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exwa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]}
dppaplplviwhgmgdsccnplsmgaikkmvekkipgihvlsleigktlredvensffln
vnsqvttvcqilakdpklqqgynamgfsqggqflravaqrcpsppmvnlisvggqhqgvf
glprcpgesshicdfirktlnagaynkaiqerlvqaeywhdpirediyrnhsifladinq
ergvnesykknlmalkkfvmvkflndtivdpvdsewfgfyrsgqaketiplqestlytqd
rlglkamdkagqlvflalegdhlqlseewfyahiipfle

SCOPe Domain Coordinates for d1exwa_:

Click to download the PDB-style file with coordinates for d1exwa_.
(The format of our PDB-style files is described here.)

Timeline for d1exwa_: