SCOPe 2.07: Domain d1cqzb2: 1cqz B:226-544

Lineage for d1cqzb2 (1cqz B:226-544)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)

6. Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [53527] (4 PDB entries)

8. Domain d1cqzb2: 1cqz B:226-544 [34690]
   Other proteins in same PDB: d1cqza1, d1cqzb1

Details for d1cqzb2

PDB Entry: 1cqz, 2.8 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase.

PDB Compounds: (B:) epoxide hydrolase

SCOPe Domain Sequences for d1cqzb2:

Sequence; same for both SEQRES and ATOM records:

>d1cqzb2 c.69.1.11 (B:226-544) Mammalian epoxide hydrolase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
lpvpcnpndvshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfr
vlaidmkgygdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalf
ypervravaslntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfks
ffrasdetgfiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwy
rnternwkwsckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwt
qiekptevnqilikwlqte

Timeline for d1cqzb2:

• d1cqzb2 first appeared (with stable ids) in SCOP 1.55
  
• d1cqzb2 appears in SCOPe 2.06
  
• d1cqzb2 appears in the current release, SCOPe 2.08