Lineage for d5mm8a1 (5mm8 A:1-202)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2407751Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2407752Protein automated matches [190438] (33 species)
    not a true protein
  7. 2408062Species Staphylococcus aureus [TaxId:1280] [187423] (6 PDB entries)
  8. 2408071Domain d5mm8a1: 5mm8 A:1-202 [346581]
    Other proteins in same PDB: d5mm8a2
    automated match to d4inka_
    complexed with act

Details for d5mm8a1

PDB Entry: 5mm8 (more details), 1.75 Å

PDB Description: atomic resolution structure of sple protease from staphylococcus aureus
PDB Compounds: (A:) Serine protease SplE

SCOPe Domain Sequences for d5mm8a1:

Sequence, based on SEQRES records: (download)

>d5mm8a1 b.47.1.0 (A:1-202) automated matches {Staphylococcus aureus [TaxId: 1280]}
ehnvklikntnvapyngvvsigsgtgfivgkntivtnkhvvagmeigahiiahpngeynn
ggfykvkkivrysgqediailhvedkavhpknrnfkdytgilkiaseakenerisivgyp
epyinkfqmyestgkvlsvkgnmiitdafvepgnsgsavfnskyevvgvhfggngpgnks
tkgygvyfspeikkfiadntdk

Sequence, based on observed residues (ATOM records): (download)

>d5mm8a1 b.47.1.0 (A:1-202) automated matches {Staphylococcus aureus [TaxId: 1280]}
ehnvklikntnvapyngvvsigsgtgfivgkntivtnkhvvagmeigahiiahpngeynn
ggfykvkkivrysgqediailhvedkavhpknrnfkdytgilkiaseakenerisivgyp
epyinkfqmyestgkvlsvkgnmiitdafvepgnsgsavfnskyevvgvhfggstkgygv
yfspeikkfiadntdk

SCOPe Domain Coordinates for d5mm8a1:

Click to download the PDB-style file with coordinates for d5mm8a1.
(The format of our PDB-style files is described here.)

Timeline for d5mm8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mm8a2