Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [187423] (6 PDB entries) |
Domain d5mm8a1: 5mm8 A:1-202 [346581] Other proteins in same PDB: d5mm8a2 automated match to d4inka_ complexed with act |
PDB Entry: 5mm8 (more details), 1.75 Å
SCOPe Domain Sequences for d5mm8a1:
Sequence, based on SEQRES records: (download)
>d5mm8a1 b.47.1.0 (A:1-202) automated matches {Staphylococcus aureus [TaxId: 1280]} ehnvklikntnvapyngvvsigsgtgfivgkntivtnkhvvagmeigahiiahpngeynn ggfykvkkivrysgqediailhvedkavhpknrnfkdytgilkiaseakenerisivgyp epyinkfqmyestgkvlsvkgnmiitdafvepgnsgsavfnskyevvgvhfggngpgnks tkgygvyfspeikkfiadntdk
>d5mm8a1 b.47.1.0 (A:1-202) automated matches {Staphylococcus aureus [TaxId: 1280]} ehnvklikntnvapyngvvsigsgtgfivgkntivtnkhvvagmeigahiiahpngeynn ggfykvkkivrysgqediailhvedkavhpknrnfkdytgilkiaseakenerisivgyp epyinkfqmyestgkvlsvkgnmiitdafvepgnsgsavfnskyevvgvhfggstkgygv yfspeikkfiadntdk
Timeline for d5mm8a1: