Lineage for d5g5va_ (5g5v A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. Protein automated matches [190983] (12 species)
    not a true protein
  7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)
  8. Domain d5g5va_: 5g5v A: [346524]
    automated match to d4i15a_
    complexed with 8z4, edo, fmt, gai, mg, zn

Details for d5g5va_

PDB Entry: 5g5v (more details), 1.8 Å

PDB Description: crystal structure of t. brucei pde-b1 catalytic domain with inhibitor npd-038
PDB Compounds: (A:) phosphodiesterase b1

SCOPe Domain Sequences for d5g5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5va_ a.211.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vkrvtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglp
qkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvl
litalvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfd
glegaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagd
isnvtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfva
apffqkivdaclqgmqwtvdriksnraqwervlet

SCOPe Domain Coordinates for d5g5va_ are not available.

Timeline for d5g5va_:

Domains from other chains:
(mouse over for more information)
d5g5vb_