![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
![]() | Protein automated matches [190983] (12 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries) |
![]() | Domain d5g5vb_: 5g5v B: [346977] automated match to d4i15a_ complexed with 8z4, edo, fmt, gai, mg, zn |
PDB Entry: 5g5v (more details), 1.8 Å
SCOPe Domain Sequences for d5g5vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g5vb_ a.211.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} taitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkfg csdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllita lvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgleg aertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisnv tkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapff qkivdaclqgmqwtvdriksnraqwervletr
Timeline for d5g5vb_: