Lineage for d5m3gb_ (5m3g B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960634Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2960635Protein automated matches [195455] (14 species)
    not a true protein
  7. 2960699Species Escherichia coli [TaxId:562] [346476] (2 PDB entries)
  8. 2960701Domain d5m3gb_: 5m3g B: [346481]
    automated match to d4rhaa_
    complexed with api, so4

Details for d5m3gb_

PDB Entry: 5m3g (more details), 2.43 Å

PDB Description: structure of the tagl peptidoglycan binding domain from eaec t6ss
PDB Compounds: (B:) OmpA family protein

SCOPe Domain Sequences for d5m3gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m3gb_ d.79.7.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
tvrlnslalfdagkwtlkpgatkwlvnalvdikakagwlivvsghtdntgdplrnqalsl
kraeavrdwmrdtgdipqscfavqgygesrpvapndtaegrarnrrveislvp

SCOPe Domain Coordinates for d5m3gb_:

Click to download the PDB-style file with coordinates for d5m3gb_.
(The format of our PDB-style files is described here.)

Timeline for d5m3gb_: