Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [189539] (12 PDB entries) |
Domain d5t2ud_: 5t2u D: [345838] Other proteins in same PDB: d5t2ua2, d5t2uc2 automated match to d5t2va_ complexed with nap |
PDB Entry: 5t2u (more details), 2.2 Å
SCOPe Domain Sequences for d5t2ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t2ud_ c.2.1.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} melegltalvtggtsgiglesarlmaaegadvvitgrdaqrgeqaaadighgarfvqadl gdldsvadlaaqapdvdilvnnagiypqastfdqdvagfqqlfdtnvrgtyflvaaaakg mvarghgsivnittlaahkgfpgtsvygatkaalesltrtwaaefgangvrvnsvspgpt rtpttleqlgdfiddvaaglplrrtaapeeiaqavlflasprasfvtgstlyvdgggyav
Timeline for d5t2ud_: