SCOPe 2.07: Domain d5t2uc1: 5t2u C:1-240

Lineage for d5t2uc1 (5t2u C:1-240)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [189539] (12 PDB entries)

8. Domain d5t2uc1: 5t2u C:1-240 [345836]
   Other proteins in same PDB: d5t2ua2, d5t2uc2
   automated match to d5t2va_
   complexed with nap

Details for d5t2uc1

PDB Entry: 5t2u, 2.2 Å

PDB Description: short chain dehydrogenase/reductase family protein

PDB Compounds: (C:) Oxidoreductase, short chain dehydrogenase/reductase family protein

SCOPe Domain Sequences for d5t2uc1:

Sequence; same for both SEQRES and ATOM records:

>d5t2uc1 c.2.1.0 (C:1-240) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
melegltalvtggtsgiglesarlmaaegadvvitgrdaqrgeqaaadighgarfvqadl
gdldsvadlaaqapdvdilvnnagiypqastfdqdvagfqqlfdtnvrgtyflvaaaakg
mvarghgsivnittlaahkgfpgtsvygatkaalesltrtwaaefgangvrvnsvspgpt
rtpttleqlgdfiddvaaglplrrtaapeeiaqavlflasprasfvtgstlyvdgggyav

Timeline for d5t2uc1:

• d5t2uc1 is new in SCOPe 2.07-stable
  
• d5t2uc1 appears in the current release, SCOPe 2.08