Lineage for d5k3hc3 (5k3h C:484-669)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2321545Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2321679Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2321680Protein automated matches [226935] (30 species)
    not a true protein
  7. 2321828Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321815] (4 PDB entries)
  8. 2321834Domain d5k3hc3: 5k3h C:484-669 [345734]
    Other proteins in same PDB: d5k3ha1, d5k3hb1, d5k3hc1, d5k3hd1, d5k3he1, d5k3hf1, d5k3hg1, d5k3hh1
    automated match to d5k3ic3

Details for d5k3hc3

PDB Entry: 5k3h (more details), 2.48 Å

PDB Description: crystals structure of acyl-coa oxidase-1 in caenorhabditis elegans, apo form-ii
PDB Compounds: (C:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3hc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k3hc3 a.29.3.0 (C:484-669) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
pnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtrlfi
veafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdqlyfy
lqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdtylk
pmmeka

SCOPe Domain Coordinates for d5k3hc3:

Click to download the PDB-style file with coordinates for d5k3hc3.
(The format of our PDB-style files is described here.)

Timeline for d5k3hc3: