Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (30 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321815] (4 PDB entries) |
Domain d5k3ha3: 5k3h A:484-669 [345728] Other proteins in same PDB: d5k3ha1, d5k3hb1, d5k3hc1, d5k3hd1, d5k3he1, d5k3hf1, d5k3hg1, d5k3hh1 automated match to d5k3ic3 |
PDB Entry: 5k3h (more details), 2.48 Å
SCOPe Domain Sequences for d5k3ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k3ha3 a.29.3.0 (A:484-669) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} pnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtrlfi veafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdqlyfy lqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdtylk pmmeka
Timeline for d5k3ha3: