Lineage for d5gtit_ (5gti T:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631879Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 2631880Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 2631881Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 2631896Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (23 PDB entries)
  8. 2631915Domain d5gtit_: 5gti T: [345663]
    Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_
    automated match to d2axtt1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtit_

PDB Entry: 5gti (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d5gtit_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtit_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d5gtit_:

Click to download the PDB-style file with coordinates for d5gtit_.
(The format of our PDB-style files is described here.)

Timeline for d5gtit_: