Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (35 PDB entries) |
Domain d5gtic_: 5gti C: [345651] Other proteins in same PDB: d5gtia_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_ automated match to d5b66c_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5gti (more details), 2.5 Å
SCOPe Domain Sequences for d5gtic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gtic_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl whagraraaaagfekgidresepvlsmpsld
Timeline for d5gtic_: