Lineage for d4qaid_ (4qai D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2415386Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2415387Protein automated matches [190048] (24 species)
    not a true protein
  7. 2415509Species Scheffersomyces stipitis [TaxId:322104] [346272] (5 PDB entries)
  8. 2415517Domain d4qaid_: 4qai D: [345425]
    automated match to d4tmca_
    complexed with fmn

Details for d4qaid_

PDB Entry: 4qai (more details), 2.75 Å

PDB Description: P. stipitis OYE2.6-Y78W
PDB Compounds: (D:) NADPH dehydrogenase

SCOPe Domain Sequences for d4qaid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qaid_ c.1.4.0 (D:) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
ssvkisplkdseafqsikvgnntlqtkivyppttrfraledhtpsdlqlqyygdrstfpg
tlliteatfvspqasgwegaapgiwtdkhakawkvitdkvhangsfvstqliflgrvadp
avmktrglnpvsasatyesdaakeaaeavgnpvralttqevkdlvyeaytnaaqkamdag
fdyielhaahgylldqflqpctnqrtdeyggsienrarlilelidhlstivgadkigiri
spwatfqnmkahkdtvhplttfsylvhelqqradkgqgiayisvveprvsgnvdvseedq
agdnefvskiwkgvilkagnysydapefktlkediadkrtlvgfsryftsnpnlvwklrd
gidlvpydrntfysdnnygyntfsmdseevdkeleikrvpsaie

SCOPe Domain Coordinates for d4qaid_:

Click to download the PDB-style file with coordinates for d4qaid_.
(The format of our PDB-style files is described here.)

Timeline for d4qaid_:

  • d4qaid_ is new in SCOPe 2.07-stable