Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Scheffersomyces stipitis [TaxId:322104] [346272] (5 PDB entries) |
Domain d4qaic_: 4qai C: [345424] automated match to d4tmca_ complexed with fmn |
PDB Entry: 4qai (more details), 2.75 Å
SCOPe Domain Sequences for d4qaic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qaic_ c.1.4.0 (C:) automated matches {Scheffersomyces stipitis [TaxId: 322104]} ssvkisplkdseafqsikvgnntlqtkivyppttrfraledhtpsdlqlqyygdrstfpg tlliteatfvspqasgwegaapgiwtdkhakawkvitdkvhangsfvstqliflgrvadp avmktrglnpvsasatyesdaakeaaeavgnpvralttqevkdlvyeaytnaaqkamdag fdyielhaahgylldqflqpctnqrtdeyggsienrarlilelidhlstivgadkigiri spwatfqnmkahkdtvhplttfsylvhelqqradkgqgiayisvveprvsgnvdvseedq agdnefvskiwkgvilkagnysydapefktlkediadkrtlvgfsryftsnpnlvwklrd gidlvpydrntfysdnnygyntfsmdseevdkeleikrvpsaie
Timeline for d4qaic_: