Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [188915] (7 PDB entries) |
Domain d4q4ab2: 4q4a B:340-593 [345419] Other proteins in same PDB: d4q4ab1 automated match to d5mkka2 complexed with anp, mg |
PDB Entry: 4q4a (more details), 2.6 Å
SCOPe Domain Sequences for d4q4ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q4ab2 c.37.1.0 (B:340-593) automated matches {Thermotoga maritima [TaxId: 243274]} kddpdavelrevrgeiefknvwfsydkkkpvlkditfhikpgqkvalvgptgsgkttivn llmrfydvdrgqilvdgidirkikrsslrssigivlqdtilfsttvkenlkygnpgatde eikeaaklthsdhfikhlpegyetvltdngedlsqgqrqllaitraflanpkilildeat snvdtkteksiqaamwklmegktsiiiahrlntiknadliivlrdgeivemgkhdeliqk rgfyyelftsqygl
Timeline for d4q4ab2: