Lineage for d4q4ab2 (4q4a B:340-593)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2481013Species Thermotoga maritima [TaxId:243274] [188915] (7 PDB entries)
  8. 2481024Domain d4q4ab2: 4q4a B:340-593 [345419]
    Other proteins in same PDB: d4q4ab1
    automated match to d5mkka2
    complexed with anp, mg

Details for d4q4ab2

PDB Entry: 4q4a (more details), 2.6 Å

PDB Description: improved model of amp-pnp bound tm287/288
PDB Compounds: (B:) Uncharacterized ABC transporter ATP-binding protein TM_0288

SCOPe Domain Sequences for d4q4ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q4ab2 c.37.1.0 (B:340-593) automated matches {Thermotoga maritima [TaxId: 243274]}
kddpdavelrevrgeiefknvwfsydkkkpvlkditfhikpgqkvalvgptgsgkttivn
llmrfydvdrgqilvdgidirkikrsslrssigivlqdtilfsttvkenlkygnpgatde
eikeaaklthsdhfikhlpegyetvltdngedlsqgqrqllaitraflanpkilildeat
snvdtkteksiqaamwklmegktsiiiahrlntiknadliivlrdgeivemgkhdeliqk
rgfyyelftsqygl

SCOPe Domain Coordinates for d4q4ab2:

Click to download the PDB-style file with coordinates for d4q4ab2.
(The format of our PDB-style files is described here.)

Timeline for d4q4ab2: