SCOPe 2.08: Domain d4q4ab2: 4q4a B:340-593

Lineage for d4q4ab2 (4q4a B:340-593)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [188915] (8 PDB entries)

8. Domain d4q4ab2: 4q4a B:340-593 [345419]
   Other proteins in same PDB: d4q4ab1
   automated match to d5mkka2
   complexed with anp, mg

Details for d4q4ab2

PDB Entry: 4q4a, 2.6 Å

PDB Description: improved model of amp-pnp bound tm287/288

PDB Compounds: (B:) Uncharacterized ABC transporter ATP-binding protein TM_0288

SCOPe Domain Sequences for d4q4ab2:

Sequence; same for both SEQRES and ATOM records:

>d4q4ab2 c.37.1.0 (B:340-593) automated matches {Thermotoga maritima [TaxId: 243274]}
kddpdavelrevrgeiefknvwfsydkkkpvlkditfhikpgqkvalvgptgsgkttivn
llmrfydvdrgqilvdgidirkikrsslrssigivlqdtilfsttvkenlkygnpgatde
eikeaaklthsdhfikhlpegyetvltdngedlsqgqrqllaitraflanpkilildeat
snvdtkteksiqaamwklmegktsiiiahrlntiknadliivlrdgeivemgkhdeliqk
rgfyyelftsqygl

Timeline for d4q4ab2:

• d4q4ab2 first appeared in SCOPe 2.07