Lineage for d1eyrb_ (1eyr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898986Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2899023Protein CMP acylneuraminate synthetase [53456] (2 species)
    a sialic acid activating synthetase
  7. 2899029Species Neisseria meningitidis [TaxId:487] [53457] (6 PDB entries)
  8. 2899037Domain d1eyrb_: 1eyr B: [34515]
    complexed with cdp

Details for d1eyrb_

PDB Entry: 1eyr (more details), 2.2 Å

PDB Description: structure of a sialic acid activating synthetase, cmp acylneuraminate synthetase in the presence and absence of cdp
PDB Compounds: (B:) cmp-n-acetylneuraminic acid synthetase

SCOPe Domain Sequences for d1eyrb_:

Sequence, based on SEQRES records: (download)

>d1eyrb_ c.68.1.13 (B:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]}
mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
ndtaslianncffiaptklyimshqdsididteldlqqaenil

Sequence, based on observed residues (ATOM records): (download)

>d1eyrb_ c.68.1.13 (B:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]}
mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
lfdekikgsvvsacpmehhplktllqineyapmrhlsdleqprqqlpqafrpngaiyind
taslianncffiaptklyimshqdsididteldlqqaenil

SCOPe Domain Coordinates for d1eyrb_:

Click to download the PDB-style file with coordinates for d1eyrb_.
(The format of our PDB-style files is described here.)

Timeline for d1eyrb_: