PDB entry 1eyr

View 1eyr on RCSB PDB site
Description: Structure of a sialic acid activating synthetase, CMP acylneuraminate synthetase in the presence and absence of CDP
Class: transferase
Keywords: synthetase, sialic acid, cdp, acylneuraminate, transferase
Deposited on 2000-05-08, released 2001-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cmp-n-acetylneuraminic acid synthetase
    Species: Neisseria meningitidis [TaxId:487]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0Z8 (0-End)
      • modified residue (0)
      • modified residue (25)
      • modified residue (135)
      • modified residue (154)
      • modified residue (201)
    Domains in SCOPe 2.07: d1eyra_
  • Chain 'B':
    Compound: cmp-n-acetylneuraminic acid synthetase
    Species: Neisseria meningitidis [TaxId:487]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0Z8 (0-End)
      • modified residue (0)
      • modified residue (25)
      • modified residue (135)
      • modified residue (154)
      • modified residue (201)
    Domains in SCOPe 2.07: d1eyrb_
  • Heterogens: CDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eyrA (A:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyrA (A:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eyrB (B:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyrB (B:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqineyapmrhlsdleqprqqlpqafrpngaiyind
    taslianncffiaptklyimshqdsididteldlqqaenil