SCOPe 2.08: Domain d1eyra_: 1eyr A:

Lineage for d1eyra_ (1eyr A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)

6. Protein CMP acylneuraminate synthetase [53456] (2 species)
   a sialic acid activating synthetase

7. Species Neisseria meningitidis [TaxId:487] [53457] (6 PDB entries)

8. Domain d1eyra_: 1eyr A: [34514]
   complexed with cdp

Details for d1eyra_

PDB Entry: 1eyr, 2.2 Å

PDB Description: structure of a sialic acid activating synthetase, cmp acylneuraminate synthetase in the presence and absence of cdp

PDB Compounds: (A:) cmp-n-acetylneuraminic acid synthetase

SCOPe Domain Sequences for d1eyra_:

Sequence; same for both SEQRES and ATOM records:

>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]}
mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
ndtaslianncffiaptklyimshqdsididteldlqqaenilnh

Timeline for d1eyra_:

• d1eyra_ first appeared (with stable ids) in SCOP 1.55
  
• d1eyra_ appears in SCOPe 2.07