| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
| Family g.3.9.0: automated matches [232406] (1 protein) not a true family |
| Protein automated matches [232407] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [346431] (1 PDB entry) |
| Domain d4c99d_: 4c99 D: [345125] automated match to d4cdkg_ complexed with cl |
PDB Entry: 4c99 (more details), 2.8 Å
SCOPe Domain Sequences for d4c99d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c99d_ g.3.9.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ickgclscskdngcsrcqqklffflrregmrqygeclhscpsgyyghrapdmnrcarcri
encdscfskdfctkckvgfylhrgrcfdecpdgfapldetmecve
Timeline for d4c99d_: