SCOPe 2.07: Domain d4c99b_: 4c99 B:

Lineage for d4c99b_ (4c99 B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.0: automated matches [232406] (1 protein)
   not a true family

6. Protein automated matches [232407] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [346431] (1 PDB entry)

8. Domain d4c99b_: 4c99 B: [345124]
   automated match to d4cdkg_
   complexed with cl

Details for d4c99b_

PDB Entry: 4c99, 2.8 Å

PDB Description: Mouse ZNRF3 ectodomain in complex with mouse RSPO2 Fu1-Fu2 crystal form I

PDB Compounds: (B:) r-spondin-2

SCOPe Domain Sequences for d4c99b_:

Sequence; same for both SEQRES and ATOM records:

>d4c99b_ g.3.9.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ickgclscskdngcsrcqqklffflrregmrqygeclhscpsgyyghrapdmnrcarcri
encdscfskdfctkckvgfylhrgrcfdecpdgfapldetmec

Timeline for d4c99b_:

• d4c99b_ is new in SCOPe 2.07-stable
  
• d4c99b_ appears in the current release, SCOPe 2.08