SCOPe 2.08: Domain d3jbre_: 3jbr E:

Lineage for d3jbre_ (3jbr E:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.63: Claudin-like [345895] (1 superfamily)
   4 transmembrane helices with 5-strand antiparallel beta-sheet, order 43215, on one side of membrane

4. Superfamily f.63.1: Claudin-like [345928] (1 family)
   Pfam PF00822
   Pfam PF13903

5. Family f.63.1.1: Claudin [345985] (3 proteins)

6. Protein L-type calcium channel Gamma-1 subunit [346125] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [346430] (1 PDB entry)

8. Domain d3jbre_: 3jbr E: [344837]
   Other proteins in same PDB: d3jbra1, d3jbra2, d3jbra3, d3jbra4, d3jbra5, d3jbrb1, d3jbrb2
   complexed with bma, ca, nag
   fragment; missing more than one-third of the common structure and/or sequence

Details for d3jbre_

PDB Entry: 3jbr, 4.2 Å

PDB Description: cryo-em structure of the rabbit voltage-gated calcium channel cav1.1 complex at 4.2 angstrom

PDB Compounds: (E:) Voltage-dependent calcium channel gamma-1 subunit

SCOPe Domain Sequences for d3jbre_:

Sequence, based on SEQRES records:

>d3jbre_ f.63.1.1 (E:) L-type calcium channel Gamma-1 subunit {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
mspteapkvrvtlfcilvgivlamtavvsdhwavlsphmenhnttceaahfglwrictkr
ialgedrscgpitlpgekncsyfrhfnpgesseifefttqkeysisaaaisvfslgflim
gticalmafrkkrdyllrpasmfyvfaglclfvslevmrqsvkrmidsedtvwieyyysw
sfacacaafvllflggislllfslpr

Sequence, based on observed residues (ATOM records):

>d3jbre_ f.63.1.1 (E:) L-type calcium channel Gamma-1 subunit {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
mspteapkvrvtlfcilvgivlamtavvsdhwavlsefttqkeysisaaaisvfslgfli
mgticalmafrkkrdyllrpasmfyvfaglclfvslevmrqsvkrmiyyyswsfacacaa
fvllflggislllfslpr

Timeline for d3jbre_:

• d3jbre_ first appeared in SCOPe 2.07