SCOPe 2.08: Domain d3jbrb1: 3jbr B:41-136

Lineage for d3jbrb1 (3jbr B:41-136)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein SH3-like domain of the L-type calcium channel [110158] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (5 PDB entries)
   Uniprot P54288

8. Domain d3jbrb1: 3jbr B:41-136 [344835]
   Other proteins in same PDB: d3jbra1, d3jbra2, d3jbra3, d3jbra4, d3jbra5, d3jbrb2, d3jbre_
   complexed with bma, ca, nag
   has additional insertions and/or extensions that are not grouped together

Details for d3jbrb1

PDB Entry: 3jbr, 4.2 Å

PDB Description: cryo-em structure of the rabbit voltage-gated calcium channel cav1.1 complex at 4.2 angstrom

PDB Compounds: (B:) Voltage-dependent L-type calcium channel subunit beta-2

SCOPe Domain Sequences for d3jbrb1:

Sequence; same for both SEQRES and ATOM records:

>d3jbrb1 b.34.2.1 (B:41-136) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn
ndwwigrlvkegceigfipspvklenmrlqheqrak

Timeline for d3jbrb1:

• d3jbrb1 first appeared in SCOPe 2.07