![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein SH3-like domain of the L-type calcium channel [110158] (2 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (5 PDB entries) Uniprot P54288 |
![]() | Domain d3jbrb1: 3jbr B:41-136 [344835] Other proteins in same PDB: d3jbra1, d3jbra2, d3jbra3, d3jbra4, d3jbra5, d3jbrb2, d3jbre_ complexed with bma, ca, nag has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3jbr (more details), 4.2 Å
SCOPe Domain Sequences for d3jbrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jbrb1 b.34.2.1 (B:41-136) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn ndwwigrlvkegceigfipspvklenmrlqheqrak
Timeline for d3jbrb1: