SCOPe 2.08: Domain d2xemd1: 2xem D:7-149

Lineage for d2xemd1 (2xem D:7-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Micromonospora chersina [TaxId:47854] [346354] (2 PDB entries)

8. Domain d2xemd1: 2xem D:7-149 [344683]
   Other proteins in same PDB: d2xema2, d2xemd2
   automated match to d5v10a_
   complexed with ssv

Details for d2xemd1

PDB Entry: 2xem, 2.1 Å

PDB Description: induced-fit and allosteric effects upon polyene binding revealed by crystal structures of the dynemicin thioesterase

PDB Compounds: (D:) dyne7

SCOPe Domain Sequences for d2xemd1:

Sequence; same for both SEQRES and ATOM records:

>d2xemd1 d.38.1.0 (D:7-149) automated matches {Micromonospora chersina [TaxId: 47854]}
mpdsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladglalvtvd
chadfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtvacmrrag
hglepvevpaelrralsryavva

Timeline for d2xemd1:

• d2xemd1 first appeared in SCOPe 2.07