Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Micromonospora chersina [TaxId:47854] [346354] (2 PDB entries) |
Domain d2xemc_: 2xem C: [344682] Other proteins in same PDB: d2xema2, d2xemd2 automated match to d5v10a_ complexed with ssv |
PDB Entry: 2xem (more details), 2.1 Å
SCOPe Domain Sequences for d2xemc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xemc_ d.38.1.0 (C:) automated matches {Micromonospora chersina [TaxId: 47854]} dsyvhrhvvtfdetnlvgnvyfahylhwqghcrehfladhapgvmaaladglalvtvdch adfyaegsafdevevrmmldrldghriamsfdyvrvapgpptllaqgrqtvacmrraghg lepvevpaelrralsryav
Timeline for d2xemc_: