SCOPe 2.08: Domain d2ecta1: 2ect A:8-78

Lineage for d2ecta1 (2ect A:8-78)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187013] (2 PDB entries)

8. Domain d2ecta1: 2ect A:8-78 [344563]
   Other proteins in same PDB: d2ecta2
   automated match to d2lxpc_
   complexed with zn

Details for d2ecta1

PDB Entry: 2ect

PDB Description: solution structure of the zinc finger, c3hc4 type (ring finger) domain of ring finger protein 126

PDB Compounds: (A:) RING finger protein 126

SCOPe Domain Sequences for d2ecta1:

Sequence; same for both SEQRES and ATOM records:

>d2ecta1 g.44.1.0 (A:8-78) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
teehvgsglecpvckedyalgesvrqlpcnhlfhdscivpwleqhdscpvcrksltgqnt
atnppgltgvg

Timeline for d2ecta1:

• d2ecta1 first appeared in SCOPe 2.07