Lineage for d1cs1d_ (1cs1 D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1613596Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1613653Protein Cystathionine gamma-synthase, CGS [53405] (2 species)
  7. 1613654Species Escherichia coli [TaxId:562] [53406] (1 PDB entry)
  8. 1613658Domain d1cs1d_: 1cs1 D: [34402]
    complexed with dhd

Details for d1cs1d_

PDB Entry: 1cs1 (more details), 1.5 Å

PDB Description: cystathionine gamma-synthase (cgs) from escherichia coli
PDB Compounds: (D:) protein (cystathionine gamma-synthase)

SCOPe Domain Sequences for d1cs1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs1d_ c.67.1.3 (D:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]}
rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
stgiedgedliadlengfraankg

SCOPe Domain Coordinates for d1cs1d_:

Click to download the PDB-style file with coordinates for d1cs1d_.
(The format of our PDB-style files is described here.)

Timeline for d1cs1d_: