SCOPe 2.04: Domain d1cs1b_: 1cs1 B:

Lineage for d1cs1b_ (1cs1 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)

6. Protein Cystathionine gamma-synthase, CGS [53405] (2 species)

7. Species Escherichia coli [TaxId:562] [53406] (1 PDB entry)

8. Domain d1cs1b_: 1cs1 B: [34400]
   complexed with dhd

Details for d1cs1b_

PDB Entry: 1cs1, 1.5 Å

PDB Description: cystathionine gamma-synthase (cgs) from escherichia coli

PDB Compounds: (B:) protein (cystathionine gamma-synthase)

SCOPe Domain Sequences for d1cs1b_:

Sequence; same for both SEQRES and ATOM records:

>d1cs1b_ c.67.1.3 (B:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]}
rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
stgiedgedliadlengfraankg

Timeline for d1cs1b_:

• d1cs1b_ first appeared (with stable ids) in SCOP 1.55
  
• d1cs1b_ appears in SCOPe 2.03
  
• d1cs1b_ appears in SCOPe 2.05
  
• d1cs1b_ appears in the current release, SCOPe 2.08