Lineage for d1bw0b_ (1bw0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131332Protein Tyrosine aminotransferase (TAT) [53395] (1 species)
  7. 2131333Species Trypanosoma cruzi [TaxId:5693] [53396] (1 PDB entry)
  8. 2131335Domain d1bw0b_: 1bw0 B: [34386]

Details for d1bw0b_

PDB Entry: 1bw0 (more details), 2.5 Å

PDB Description: crystal structure of tyrosine aminotransferase from trypanosoma cruzi
PDB Compounds: (B:) protein (tyrosine aminotransferase)

SCOPe Domain Sequences for d1bw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw0b_ c.67.1.1 (B:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]}
wdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklkeai
dsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilmaita
icdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktklliv
tnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfettv
prvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalgeal
lntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdiktdve
ffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaav

SCOPe Domain Coordinates for d1bw0b_:

Click to download the PDB-style file with coordinates for d1bw0b_.
(The format of our PDB-style files is described here.)

Timeline for d1bw0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bw0a_