Lineage for d1bw0b_ (1bw0 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26198Family c.67.1.1: AAT-like [53384] (3 protein domains)
  6. 26344Protein Tyrosine aminotransferase (TAT) [53395] (1 species)
  7. 26345Species Trypanosoma cruzi [TaxId:5693] [53396] (1 PDB entry)
  8. 26347Domain d1bw0b_: 1bw0 B: [34386]

Details for d1bw0b_

PDB Entry: 1bw0 (more details), 2.5 Å

PDB Description: crystal structure of tyrosine aminotransferase from trypanosoma cruzi

SCOP Domain Sequences for d1bw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw0b_ c.67.1.1 (B:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi}
wdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklkeai
dsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilmaita
icdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktklliv
tnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfettv
prvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalgeal
lntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdiktdve
ffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaav

SCOP Domain Coordinates for d1bw0b_:

Click to download the PDB-style file with coordinates for d1bw0b_.
(The format of our PDB-style files is described here.)

Timeline for d1bw0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bw0a_