PDB entry 1bw0

View 1bw0 on RCSB PDB site
Description: crystal structure of tyrosine aminotransferase from trypanosoma cruzi
Class: transferase
Keywords: tyrosine catabolism, transferase, aminotransferase, pyridoxal-5'-phosphate, plp
Deposited on 1998-09-28, released 1999-09-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.157
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tyrosine aminotransferase)
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33447
      • modified residue (252)
    Domains in SCOPe 2.06: d1bw0a_
  • Chain 'B':
    Compound: protein (tyrosine aminotransferase)
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33447 (Start-415)
      • modified residue (252)
    Domains in SCOPe 2.06: d1bw0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bw0A (A:)
    msswdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklk
    eaidsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilma
    itaicdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktkl
    livtnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfe
    ttvprvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalg
    eallntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdikt
    dveffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bw0A (A:)
    wdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklkeai
    dsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilmaita
    icdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktklliv
    tnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfettv
    prvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalgeal
    lntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdiktdve
    ffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bw0B (B:)
    msswdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklk
    eaidsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilma
    itaicdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktkl
    livtnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfe
    ttvprvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalg
    eallntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdikt
    dveffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bw0B (B:)
    wdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklkeai
    dsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilmaita
    icdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktklliv
    tnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfettv
    prvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalgeal
    lntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdiktdve
    ffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaav