Lineage for d5ybwa_ (5ybw A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2157251Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2157252Protein automated matches [190215] (33 species)
    not a true protein
  7. 2157430Species Scapharca broughtonii [TaxId:148819] [343306] (1 PDB entry)
  8. 2157431Domain d5ybwa_: 5ybw A: [343337]
    automated match to d3l6cb_

Details for d5ybwa_

PDB Entry: 5ybw (more details), 1.9 Å

PDB Description: crystal structure of pyridoxal 5'-phosphate-dependent aspartate racemase
PDB Compounds: (A:) aspartate racemase

SCOPe Domain Sequences for d5ybwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ybwa_ c.79.1.0 (A:) automated matches {Scapharca broughtonii [TaxId: 148819]}
ipqfevtvtdikkaydriskhilytpvftsptfdrmvgskagrqfyfkaenlqktgsfka
rgalnailcalerepslagvvthssgnhgqalawaskragvkccvvvpktapqvkfdame
nygaevvkcepnptsrketceglaksrgykyisssddydviagqgtialellqqqpdlda
ilvsvsaggmasgicvytkntksdlkvflvepegkmleeciskrerlwpnppqfldtiad
giilqqcgnktwpiilelpekevitvnndniveamrfvfarmklvieaaagatvaaamte
rfqnfhpeakkvgiilcggnvdieklpwt

SCOPe Domain Coordinates for d5ybwa_:

Click to download the PDB-style file with coordinates for d5ybwa_.
(The format of our PDB-style files is described here.)

Timeline for d5ybwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ybwb_