SCOPe 2.08: Domain d5oska1: 5osk A:1-245

Lineage for d5oska1 (5osk A:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d5oska1: 5osk A:1-245 [343202]
   Other proteins in same PDB: d5oska2, d5oskb2, d5oskc2, d5oskd2, d5oske_, d5oskf1, d5oskf2, d5oskf3
   automated match to d4ihja1
   complexed with a9q, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5oska1

PDB Entry: 5osk, 2.11 Å

PDB Description: tubulin-7j complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5oska1:

Sequence; same for both SEQRES and ATOM records:

>d5oska1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5oska1:

• d5oska1 first appeared in SCOPe 2.06
  
• d5oska1 appears in SCOPe 2.07