![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
![]() | Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
![]() | Domain d5oskf3: 5osk F:77-378 [344390] Other proteins in same PDB: d5oska1, d5oska2, d5oskb1, d5oskb2, d5oskc1, d5oskc2, d5oskd1, d5oskd2, d5oske_, d5oskf1, d5oskf2 complexed with a9q, acp, ca, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 5osk (more details), 2.11 Å
SCOPe Domain Sequences for d5oskf3:
Sequence, based on SEQRES records: (download)
>d5oskf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5oskf3 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptderevflaaynrrreggnvwiaksseasehviq kylekplllepghrkfdirswvlvdhlyniylyregvlrtssepynsadktchltnhciq kygryeegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqs fqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfplatsifikl
Timeline for d5oskf3: