Lineage for d5oske_ (5osk E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2734007Domain d5oske_: 5osk E: [343172]
    Other proteins in same PDB: d5oska1, d5oska2, d5oskb1, d5oskb2, d5oskc1, d5oskc2, d5oskd1, d5oskd2, d5oskf1, d5oskf2, d5oskf3
    automated match to d4i55e_
    complexed with a9q, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5oske_

PDB Entry: 5osk (more details), 2.11 Å

PDB Description: tubulin-7j complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5oske_:

Sequence, based on SEQRES records: (download)

>d5oske_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d5oske_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d5oske_:

Click to download the PDB-style file with coordinates for d5oske_.
(The format of our PDB-style files is described here.)

Timeline for d5oske_: