SCOPe 2.08: Domain d5mkng_: 5mkn G:

Lineage for d5mkng_ (5mkn G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (14 species)
   not a true protein

7. Species Methanococcus vannielii [TaxId:2187] [343057] (1 PDB entry)

8. Domain d5mkng_: 5mkn G: [343090]
   automated match to d1mgqa_
   complexed with pg4, u5p

Details for d5mkng_

PDB Entry: 5mkn, 2.55 Å

PDB Description: crystal structure of smap (lsm) protein from methanococcus vannielii

PDB Compounds: (G:) Like-Sm ribonucleoprotein core

SCOPe Domain Sequences for d5mkng_:

Sequence, based on SEQRES records:

>d5mkng_ b.38.1.0 (G:) automated matches {Methanococcus vannielii [TaxId: 2187]}
mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
vrgdnvlyvsl

Sequence, based on observed residues (ATOM records):

>d5mkng_ b.38.1.0 (G:) automated matches {Methanococcus vannielii [TaxId: 2187]}
mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiekefpmlvvrgd
nvlyvsl

Timeline for d5mkng_:

• d5mkng_ first appeared in SCOPe 2.06
  
• d5mkng_ appears in SCOPe 2.07