Lineage for d5mknn_ (5mkn N:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787637Species Methanococcus vannielii [TaxId:2187] [343057] (1 PDB entry)
  8. 2787651Domain d5mknn_: 5mkn N: [343075]
    automated match to d1mgqa_
    complexed with pg4, u5p

Details for d5mknn_

PDB Entry: 5mkn (more details), 2.55 Å

PDB Description: crystal structure of smap (lsm) protein from methanococcus vannielii
PDB Compounds: (N:) Like-Sm ribonucleoprotein core

SCOPe Domain Sequences for d5mknn_:

Sequence, based on SEQRES records: (download)

>d5mknn_ b.38.1.0 (N:) automated matches {Methanococcus vannielii [TaxId: 2187]}
mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
vrgdnvlyvsl

Sequence, based on observed residues (ATOM records): (download)

>d5mknn_ b.38.1.0 (N:) automated matches {Methanococcus vannielii [TaxId: 2187]}
mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakieeekefpmlvvr
gdnvlyvsl

SCOPe Domain Coordinates for d5mknn_:

Click to download the PDB-style file with coordinates for d5mknn_.
(The format of our PDB-style files is described here.)

Timeline for d5mknn_: