Lineage for d5m4zb_ (5m4z B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579306Species Trichinella spiralis [TaxId:6334] [226731] (2 PDB entries)
  8. 2579308Domain d5m4zb_: 5m4z B: [343049]
    automated match to d4irra_
    complexed with 7k8, gol

Details for d5m4zb_

PDB Entry: 5m4z (more details), 1.18 Å

PDB Description: crystal structure of the complex of t.spiralis thymidylate synthase with n(4)-hydroxy-2'-deoxycytidine-5'-monophosphate, crystallized in the presence of n(5,10)-methylenetetrahydrofolate
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d5m4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m4zb_ d.117.1.1 (B:) automated matches {Trichinella spiralis [TaxId: 6334]}
yvnqeelnylnqlkdiidhgvrkndrtgigtlstfgtqsryclrddifpllttkrvfwrg
vveellwfisgstnakqlseknvniwdgnssrefldsrglynyeegdlgpvygfqwrhfg
cpyssmtadykgkgydqlqqcikmireepesrriimtawnpcdlekvalppchcfvqfyv
adgelscqmyqrsadmglgvpfniasyslltrmiahitslkpgffihtigdahvylthvd
alkvqmerkprpfpklkilrnveniddfraedfelinykpypkism

SCOPe Domain Coordinates for d5m4zb_:

Click to download the PDB-style file with coordinates for d5m4zb_.
(The format of our PDB-style files is described here.)

Timeline for d5m4zb_: