SCOPe 2.08: Domain d5m4zb_: 5m4z B:

Lineage for d5m4zb_ (5m4z B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Trichinella spiralis [TaxId:6334] [226731] (2 PDB entries)

8. Domain d5m4zb_: 5m4z B: [343049]
   automated match to d4irra_
   complexed with 7k8, gol

Details for d5m4zb_

PDB Entry: 5m4z, 1.18 Å

PDB Description: crystal structure of the complex of t.spiralis thymidylate synthase with n(4)-hydroxy-2'-deoxycytidine-5'-monophosphate, crystallized in the presence of n(5,10)-methylenetetrahydrofolate

PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d5m4zb_:

Sequence; same for both SEQRES and ATOM records:

>d5m4zb_ d.117.1.1 (B:) automated matches {Trichinella spiralis [TaxId: 6334]}
yvnqeelnylnqlkdiidhgvrkndrtgigtlstfgtqsryclrddifpllttkrvfwrg
vveellwfisgstnakqlseknvniwdgnssrefldsrglynyeegdlgpvygfqwrhfg
cpyssmtadykgkgydqlqqcikmireepesrriimtawnpcdlekvalppchcfvqfyv
adgelscqmyqrsadmglgvpfniasyslltrmiahitslkpgffihtigdahvylthvd
alkvqmerkprpfpklkilrnveniddfraedfelinykpypkism

Timeline for d5m4zb_:

• d5m4zb_ first appeared in SCOPe 2.06
  
• d5m4zb_ appears in SCOPe 2.07