SCOPe 2.08: Domain d6blqa2: 6blq A:83-180

Lineage for d6blqa2 (6blq A:83-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d6blqa2: 6blq A:83-180 [342999]
   Other proteins in same PDB: d6blqa1
   automated match to d1f3ja1
   complexed with edo, ipa, nag

Details for d6blqa2

PDB Entry: 6blq, 1.8 Å

PDB Description: crystal structure of iag7 in complex with insulin mimotope p8e9e

PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d6blqa2:

Sequence; same for both SEQRES and ATOM records:

>d6blqa2 b.1.1.2 (A:83-180) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwep

Timeline for d6blqa2:

• d6blqa2 first appeared in SCOPe 2.06
  
• d6blqa2 appears in SCOPe 2.07