Lineage for d5trmu_ (5trm U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969240Domain d5trmu_: 5trm U: [342354]
    automated match to d5gcna_

Details for d5trmu_

PDB Entry: 5trm (more details), 2.9 Å

PDB Description: crystal structure of human gcn5 histone acetyltransferase domain
PDB Compounds: (U:) Histone acetyltransferase KAT2A

SCOPe Domain Sequences for d5trmu_:

Sequence, based on SEQRES records: (download)

>d5trmu_ d.108.1.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giiefhvignsltpkanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikd
grviggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyade
yaigyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt

Sequence, based on observed residues (ATOM records): (download)

>d5trmu_ d.108.1.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giiefhvignsltpnrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalikdgr
viggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyadeya
igyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt

SCOPe Domain Coordinates for d5trmu_:

Click to download the PDB-style file with coordinates for d5trmu_.
(The format of our PDB-style files is described here.)

Timeline for d5trmu_: