Lineage for d5lu5c_ (5lu5 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515496Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2515497Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2515715Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2515716Protein automated matches [190547] (16 species)
    not a true protein
  7. 2515722Species Burkholderia pseudomallei [TaxId:272560] [189351] (5 PDB entries)
  8. 2515725Domain d5lu5c_: 5lu5 C: [342353]
    automated match to d2xbld_
    complexed with act, gol, m7p, mg, na, peg, pg4, pge

Details for d5lu5c_

PDB Entry: 5lu5 (more details), 1.55 Å

PDB Description: a quantum half-site enzyme
PDB Compounds: (C:) Phosphoheptose isomerase

SCOPe Domain Sequences for d5lu5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lu5c_ c.80.1.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada
qhiagqfvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy
stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlvlg
hivcglvehsifg

SCOPe Domain Coordinates for d5lu5c_:

Click to download the PDB-style file with coordinates for d5lu5c_.
(The format of our PDB-style files is described here.)

Timeline for d5lu5c_: