![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
![]() | Protein automated matches [190547] (16 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:272560] [189351] (5 PDB entries) |
![]() | Domain d5lu5c_: 5lu5 C: [342353] automated match to d2xbld_ complexed with act, gol, m7p, mg, na, peg, pg4, pge |
PDB Entry: 5lu5 (more details), 1.55 Å
SCOPe Domain Sequences for d5lu5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lu5c_ c.80.1.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 272560]} nreltyitnsiaeaqrvmaamladerllatvrkvadaciasiaqggkvllagnggsaada qhiagqfvsrfafdrpglpavalttdtsiltaigndygyeklfsrqvqalgnegdvligy stsgkspnilaafreakakgmtcvgftgnrggemrelcdlllevpsadtpkiqeghlvlg hivcglvehsifg
Timeline for d5lu5c_: