Lineage for d4mhta_ (4mht A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1000062Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (4 proteins)
  6. 1000067Protein DNA methylase HhaI [53367] (2 species)
  7. 1000068Species Haemophilus haemolyticus [TaxId:726] [53368] (21 PDB entries)
    Uniprot P05102
  8. 1000078Domain d4mhta_: 4mht A: [34230]
    protein/DNA complex; complexed with sah

Details for d4mhta_

PDB Entry: 4mht (more details), 2.7 Å

PDB Description: ternary structure of hhai methyltransferase with native dna and adohcy
PDB Compounds: (A:) protein (hhai methyltransferase (e.c.2.1.1.73))

SCOPe Domain Sequences for d4mhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhta_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOPe Domain Coordinates for d4mhta_:

Click to download the PDB-style file with coordinates for d4mhta_.
(The format of our PDB-style files is described here.)

Timeline for d4mhta_: