Lineage for d5w12d_ (5w12 D:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2619752Species Acinetobacter baumannii [TaxId:470] [194613] (63 PDB entries)
  8. 2619824Domain d5w12d_: 5w12 D: [342153]
    automated match to d4neta_
    complexed with 9tg

Details for d5w12d_

PDB Entry: 5w12 (more details), 1.88 Å

PDB Description: adc-7 in complex with boronic acid transition state inhibitor ec04
PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d5w12d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w12d_ e.3.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 470]}
pkdqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsntifel
gsvsklftataggyaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalqfp
devqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlektifpal
glkhsyvnvpktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanlnpq
kyptdiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvtais
kepsvkmyhktgstsgfgtyvvfipkeniglvmltnkripneerikaayvvlnai

SCOPe Domain Coordinates for d5w12d_:

Click to download the PDB-style file with coordinates for d5w12d_.
(The format of our PDB-style files is described here.)

Timeline for d5w12d_: